PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00107.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family STAT
Protein Properties Length: 334aa    MW: 37039.3 Da    PI: 5.4081
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00107.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT206.52.1e-64251461122
           STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkyp 96 
                    ldvvl+na++q+++ + ev asLlyad+gl+vek++daeapLLisydG+ef+s+drp+kll+GrasfklkisqLsskcdnrLf+ikfe+p++  y+
  Jcr4S00107.30  25 LDVVLSNAISQSINNEAEVAASLLYADNGLPVEKTSDAEAPLLISYDGIEFASSDRPSKLLHGRASFKLKISQLSSKCDNRLFCIKFELPEFGGYH 120
                    8*********************************************************************************************** PP

           STAT  97 fleavskpirCisrsrntrsssltkk 122
                    fl+a+s+pirCisrsrn r+sslt+k
  Jcr4S00107.30 121 FLQAFSHPIRCISRSRNPRTSSLTWK 146
                    **********************9997 PP

Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MLLLQAFFSW KFCVFQASCR RIFSLDVVLS NAISQSINNE AEVAASLLYA DNGLPVEKTS  60
DAEAPLLISY DGIEFASSDR PSKLLHGRAS FKLKISQLSS KCDNRLFCIK FELPEFGGYH  120
FLQAFSHPIR CISRSRNPRT SSLTWKRPTS ASYPLNGPQP HGLDNGSVEF QQSSFHETKP  180
SPSSKRVKLG KENNYTLEQP DEECNSHACT ANQVEDAFRT RLDESPDNPE EVDNSATDSE  240
STEENNLNFK VASGGGYPIS DLTIFKYCLG GLTDRALLLK EVAASASEED LLRFAHEISL  300
YSGCSHHRDF KPGGQNSLAY QYTSIMTFGI SLDA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070217.10.0PREDICTED: uncharacterized protein LOC105632445
TrEMBLA0A067KUI30.0A0A067KUI3_JATCU; Uncharacterized protein
STRINGVIT_19s0014g00140.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67103036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.12e-77SH2 domain protein B